SCOPe 2.05: Domain d1mmyb_: 1mmy B:

Lineage for d1mmyb_ (1mmy B:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.30: Supersandwich [49993] (3 superfamilies)
   sandwich; 18 strands in 2 sheets

4. Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families)
   probable carbohydrate-binding domain in enzymes acting on sugars

5. Family b.30.5.4: Aldose 1-epimerase (mutarotase) [74911] (2 proteins)
   automatically mapped to Pfam PF01263

6. Protein Galactose mutarotase [74912] (3 species)

7. Species Lactococcus lactis [TaxId:1358] [74913] (19 PDB entries)

8. Domain d1mmyb_: 1mmy B: [79308]
   complexed with g6d, na

Details for d1mmyb_

PDB Entry: 1mmy, 1.85 Å

PDB Description: crystal structure of galactose mutarotase from lactococcus lactis complexed with d-quinovose

PDB Compounds: (B:) aldose 1-epimerase

SCOPe Domain Sequences for d1mmyb_:

Sequence; same for both SEQRES and ATOM records:

>d1mmyb_ b.30.5.4 (B:) Galactose mutarotase {Lactococcus lactis [TaxId: 1358]}
sikirdfglgsdlisltnkagvtisftnlgarivdwqkdgkhlilgfdsakeylekdayp
gatvgptagrikdglvkisgkdyilnqnegpqtlhggeesihtklwtyevtdlgaevqvk
fslvsndgtngypgkiemsvthsfdddnkwkihyeaisdkdtvfnptghvyfnlngdase
svenhglrlaasrfvplkdqteivrgdivdikntdldfrqekqlsnafnsnmeqvqlvkg
idhpflldqlgldkeqarltlddtsisvftdqpsiviftanfgdlgtlyhekkqvhhggi
tfecqvspgseqipelgdislkagekyqattiyslhtklehhhhhh

Timeline for d1mmyb_:

• d1mmyb_ first appeared in SCOP 1.63
  
• d1mmyb_ appears in SCOPe 2.04
  
• d1mmyb_ is called d1mmyb1 in SCOPe 2.06
  
• d1mmyb_ appears in the current release, SCOPe 2.08, called d1mmyb1