Lineage for d1mmxa1 (1mmx A:2-339)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2391115Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 2391261Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families) (S)
    probable carbohydrate-binding domain in enzymes acting on sugars
  5. 2391546Family b.30.5.4: Aldose 1-epimerase (mutarotase) [74911] (2 proteins)
    automatically mapped to Pfam PF01263
  6. 2391551Protein Galactose mutarotase [74912] (3 species)
  7. 2391561Species Lactococcus lactis [TaxId:1358] [74913] (19 PDB entries)
  8. 2391568Domain d1mmxa1: 1mmx A:2-339 [79305]
    Other proteins in same PDB: d1mmxa2, d1mmxb2
    complexed with fuc, na

Details for d1mmxa1

PDB Entry: 1mmx (more details), 1.8 Å

PDB Description: crystal structure of galactose mutarotase from lactococcus lactis complexed with d-fucose
PDB Compounds: (A:) aldose 1-epimerase

SCOPe Domain Sequences for d1mmxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mmxa1 b.30.5.4 (A:2-339) Galactose mutarotase {Lactococcus lactis [TaxId: 1358]}
sikirdfglgsdlisltnkagvtisftnlgarivdwqkdgkhlilgfdsakeylekdayp
gatvgptagrikdglvkisgkdyilnqnegpqtlhggeesihtklwtyevtdlgaevqvk
fslvsndgtngypgkiemsvthsfdddnkwkihyeaisdkdtvfnptghvyfnlngdase
svenhglrlaasrfvplkdqteivrgdivdikntdldfrqekqlsnafnsnmeqvqlvkg
idhpflldqlgldkeqarltlddtsisvftdqpsiviftanfgdlgtlyhekkqvhhggi
tfecqvspgseqipelgdislkagekyqattiyslhtk

SCOPe Domain Coordinates for d1mmxa1:

Click to download the PDB-style file with coordinates for d1mmxa1.
(The format of our PDB-style files is described here.)

Timeline for d1mmxa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1mmxa2