Lineage for d1mm7a_ (1mm7 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2913607Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2913608Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2913609Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
    has additional insertions and/or extensions that are not grouped together
  6. 2913863Protein Glutamate receptor ligand binding core [53881] (5 species)
  7. 2913899Species Norway rat (Rattus norvegicus), GluR2 [TaxId:10116] [53882] (158 PDB entries)
  8. 2913977Domain d1mm7a_: 1mm7 A: [79298]
    complexed with qus, zn

Details for d1mm7a_

PDB Entry: 1mm7 (more details), 1.65 Å

PDB Description: crystal structure of the glur2 ligand binding core (s1s2j) in complex with quisqualate in a zinc crystal form at 1.65 angstroms resolution
PDB Compounds: (A:) Glutamate receptor 2

SCOPe Domain Sequences for d1mm7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mm7a_ c.94.1.1 (A:) Glutamate receptor ligand binding core {Norway rat (Rattus norvegicus), GluR2 [TaxId: 10116]}
ktvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgkyga
rdadtkiwngmvgelvygkadiaiapltitlvreevidfskpfmslgisimikkgtpies
aedlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvarvrk
skgkyayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslgnavnlavlklne
qglldklknkwwydkgec

SCOPe Domain Coordinates for d1mm7a_:

Click to download the PDB-style file with coordinates for d1mm7a_.
(The format of our PDB-style files is described here.)

Timeline for d1mm7a_: