Lineage for d1mlvc2 (1mlv C:50-310)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2427208Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 2427940Superfamily b.85.7: SET domain [82199] (4 families) (S)
    duplication: the core is composed of two structural repeats similar to (circularly permuted) repeats of AFPIII
    also contains a substrate-binding alpha+beta subdomain inserted in the core
  5. 2427995Family b.85.7.3: RuBisCo LSMT catalytic domain [82210] (1 protein)
  6. 2427996Protein RuBisCo LSMT catalytic domain [82211] (1 species)
  7. 2427997Species Pea (Pisum sativum) [TaxId:3888] [82212] (7 PDB entries)
  8. 2428015Domain d1mlvc2: 1mlv C:50-310 [79288]
    Other proteins in same PDB: d1mlva1, d1mlva3, d1mlvb1, d1mlvb3, d1mlvc1, d1mlvc3
    complexed with epe, sah

Details for d1mlvc2

PDB Entry: 1mlv (more details), 2.6 Å

PDB Description: structure and catalytic mechanism of a set domain protein methyltransferase
PDB Compounds: (C:) Ribulose-1,5 biphosphate carboxylase/oxygenase large subunit N-methyltransferase

SCOPe Domain Sequences for d1mlvc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mlvc2 b.85.7.3 (C:50-310) RuBisCo LSMT catalytic domain {Pea (Pisum sativum) [TaxId: 3888]}
lspavqtfwkwlqeegvitaktpvkasvvteglglvalkdisrndvilqvpkrlwinpda
vaaseigrvcselkpwlsvilflirersredsvwkhyfgilpqetdstiywseeelqelq
gsqllkttvsvkeyvkneclkleqeiilpnkrlfpdpvtlddffwafgilrsrafsrlrn
enlvvvpmadlinhsagvttedhayevkgaaglfswdylfslksplsvkageqvyiqydl
nksnaelaldygfiepnenrh

SCOPe Domain Coordinates for d1mlvc2:

Click to download the PDB-style file with coordinates for d1mlvc2.
(The format of our PDB-style files is described here.)

Timeline for d1mlvc2: