Lineage for d1ml5z_ (1ml5 Z:)

  1. Root: SCOPe 2.06
  2. 2268314Class i: Low resolution protein structures [58117] (25 folds)
  3. 2268315Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 2268316Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 2268317Family i.1.1.1: Ribosome complexes [58120] (3 proteins)
  6. 2268318Protein 70S ribosome functional complex [58121] (4 species)
  7. 2268319Species Escherichia coli [TaxId:562] [58123] (72 PDB entries)
  8. 2268422Domain d1ml5z_: 1ml5 Z: [79280]
    also include low case chains a;b;c;d;e;f;g;h;l;m;n;o;p;q;r;s;t;u;v;w;x
    termination complex with release factor 2

Details for d1ml5z_

PDB Entry: 1ml5 (more details), 14 Å

PDB Description: structure of the e. coli ribosomal termination complex with release factor 2
PDB Compounds: (Z:) Peptide chain release factor 2

SCOPe Domain Sequences for d1ml5z_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ml5z_ i.1.1.1 (Z:) 70S ribosome functional complex {Escherichia coli [TaxId: 562]}
inpvnnriqdltersdvlrgyldydakkerleevnaeleqpdvwneperaqalgkerssl
eavvdtldqmkqgledvsgllelaveaddeetfneavaeldaleeklaqlefrrmfsgey
dsadcyldiqagsggteaqdwasmlermylrwaesrgfkteiieesegevagiksvtiki
sgdyaygwlrtetgvhrlvrkspfdsggrrhtsfssafvypevdddidieinpadlridv
yrtsgaggqhvnrtesavrithiptgivtqcqndrsqhknkdqamkqmkaklyelemqkk
naekqamednksdigwgsqirsyvlddsrikdlrtgvetrntqavldgsldqfieaslka
gl

SCOPe Domain Coordinates for d1ml5z_:

Click to download the PDB-style file with coordinates for d1ml5z_.
(The format of our PDB-style files is described here.)

Timeline for d1ml5z_: