Lineage for d1ml5q_ (1ml5 Q:)

  1. Root: SCOPe 2.02
  2. 1248417Class i: Low resolution protein structures [58117] (25 folds)
  3. 1248418Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 1248419Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 1248420Family i.1.1.1: Ribosome complexes [58120] (1 protein)
  6. 1248421Protein 70S ribosome functional complex [58121] (9 species)
  7. 1248493Species Escherichia coli [TaxId:562] [58123] (72 PDB entries)
  8. 1248676Domain d1ml5q_: 1ml5 Q: [79272]
    also include low case chains a;b;c;d;e;f;g;h;l;m;n;o;p;q;r;s;t;u;v;w;x
    termination complex with release factor 2

Details for d1ml5q_

PDB Entry: 1ml5 (more details), 14 Å

PDB Description: structure of the e. coli ribosomal termination complex with release factor 2
PDB Compounds: (Q:) 30S ribosomal protein S14

SCOPe Domain Sequences for d1ml5q_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ml5q_ i.1.1.1 (Q:) 70S ribosome functional complex {Escherichia coli [TaxId: 562]}
arkaliekakrtpkfkvraytrcvrcgrarsvyrffglcriclrelahkgqlpgvrkasw

SCOPe Domain Coordinates for d1ml5q_:

Click to download the PDB-style file with coordinates for d1ml5q_.
(The format of our PDB-style files is described here.)

Timeline for d1ml5q_: