Lineage for d1ml5j_ (1ml5 J:)

  1. Root: SCOP 1.71
  2. 627044Class i: Low resolution protein structures [58117] (24 folds)
  3. 627045Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 627046Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 627047Family i.1.1.1: Ribosome complexes [58120] (1 protein)
  6. 627048Protein 70S ribosome functional complex [58121] (3 species)
  7. 627097Species Escherichia coli [TaxId:562] [58123] (39 PDB entries)
  8. 627342Domain d1ml5j_: 1ml5 J: [79265]

Details for d1ml5j_

PDB Entry: 1ml5 (more details)

PDB Description: structure of the e. coli ribosomal termination complex with release factor 2

SCOP Domain Sequences for d1ml5j_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ml5j_ i.1.1.1 (J:) 70S ribosome functional complex {Escherichia coli}
arrrraevrqlqpdlvygdvlvtafinkimrdgkknlaarifydackiiqektgqeplkv
fkqavenvkprmevrsrrvgganyqvpmevsprrqqslalrwlvqaanqrperraavria
helmdaaegkggavkkkedvermaeanrayahyrw

SCOP Domain Coordinates for d1ml5j_:

Click to download the PDB-style file with coordinates for d1ml5j_.
(The format of our PDB-style files is described here.)

Timeline for d1ml5j_: