Lineage for d1mkya3 (1mky A:359-439)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 503440Fold d.52: Alpha-lytic protease prodomain-like [54805] (7 superfamilies)
    core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta
  4. 503509Superfamily d.52.5: Probable GTPase Der, C-terminal domain [82653] (1 family) (S)
    possible distant relative of the Era C-terminal domain lacking the KH motif
  5. 503510Family d.52.5.1: Probable GTPase Der, C-terminal domain [82654] (1 protein)
  6. 503511Protein Probable GTPase Der, C-terminal domain [82655] (1 species)
  7. 503512Species Thermotoga maritima [TaxId:243274] [82656] (1 PDB entry)
  8. 503513Domain d1mkya3: 1mky A:359-439 [79252]
    Other proteins in same PDB: d1mkya1, d1mkya2

Details for d1mkya3

PDB Entry: 1mky (more details), 1.9 Å

PDB Description: Structural Analysis of the Domain Interactions in Der, a Switch Protein Containing Two GTPase Domains

SCOP Domain Sequences for d1mkya3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mkya3 d.52.5.1 (A:359-439) Probable GTPase Der, C-terminal domain {Thermotoga maritima}
kvpssainsalqkvlaftnlprglkiffgvqvdikpptflffvnsiekvknpqkiflrkl
irdyvfpfegspiflkfkrsr

SCOP Domain Coordinates for d1mkya3:

Click to download the PDB-style file with coordinates for d1mkya3.
(The format of our PDB-style files is described here.)

Timeline for d1mkya3: