Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) division into families based on beta-sheet topologies |
Family c.37.1.8: G proteins [52592] (79 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
Protein Probable GTPase Der, N-terminal and middle domains [82406] (1 species) member of EngA subfamily of GTPases; contains two G domains |
Species Thermotoga maritima [TaxId:2336] [82407] (1 PDB entry) |
Domain d1mkya1: 1mky A:2-172 [79250] Other proteins in same PDB: d1mkya3 complexed with gdp, po4 |
PDB Entry: 1mky (more details), 1.9 Å
SCOPe Domain Sequences for d1mkya1:
Sequence, based on SEQRES records: (download)
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} atvlivgrpnvgkstlfnklvkkkkaivedeegvtrdpvqdtvewygktfklvdtcgvfd npqdiisqkmkevtlnmireadlvlfvvdgkrgitkedesladflrkstvdtilvankae nlreferevkpelyslgfgepipvsaehninldtmletiikkleekgldle
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} atvlivgrpnvgkstlfnklvkdpvqdtvewygktfklvdtcgvfdnpqdiisqkmkevt lnmireadlvlfvvdgkrgitkedesladflrkstvdtilvankaenlreferevkpely slgfgepipvsaehninldtmletiikkleekgldle
Timeline for d1mkya1: