Lineage for d1mkkb_ (1mkk B:)

  1. Root: SCOP 1.65
  2. 341323Class g: Small proteins [56992] (66 folds)
  3. 343283Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
    disulphide-rich fold; common core is all-beta
  4. 343284Superfamily g.17.1: Cystine-knot cytokines [57501] (7 families) (S)
  5. 343285Family g.17.1.1: Platelet-derived growth factor-like [57502] (3 proteins)
  6. 343295Protein Vascular endothelial growth factor, VEGF [57505] (1 species)
  7. 343296Species Human (Homo sapiens) [TaxId:9606] [57506] (11 PDB entries)
  8. 343324Domain d1mkkb_: 1mkk B: [79241]
    disulfide deficient mutant

Details for d1mkkb_

PDB Entry: 1mkk (more details), 1.32 Å

PDB Description: disulfide deficient mutant of vascular endothelial growth factor a (c61a and c104a)

SCOP Domain Sequences for d1mkkb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mkkb_ g.17.1.1 (B:) Vascular endothelial growth factor, VEGF {Human (Homo sapiens)}
mvvkfmdvyqrsychpietlvdifqeypdeieyifkpscvplmrcggcandeglecvpte
esnitmqimrikphqgqhigemsflqhnkcearp

SCOP Domain Coordinates for d1mkkb_:

Click to download the PDB-style file with coordinates for d1mkkb_.
(The format of our PDB-style files is described here.)

Timeline for d1mkkb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1mkka_