Lineage for d1mkha_ (1mkh A:)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 228551Fold b.40: OB-fold [50198] (9 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 229103Superfamily b.40.4: Nucleic acid-binding proteins [50249] (10 families) (S)
  5. 229247Family b.40.4.4: Myf domain [50277] (4 proteins)
  6. 229248Protein C-terminal domain of methionyl-tRNA synthetase, MetRS-CD [82102] (1 species)
  7. 229249Species Archaeon Pyrococcus abyssi [TaxId:29292] [82103] (1 PDB entry)
  8. 229250Domain d1mkha_: 1mkh A: [79238]

Details for d1mkha_

PDB Entry: 1mkh (more details), 2.01 Å

PDB Description: C-terminal domain of methionyl-tRNA synthetase from Pyrococcus abyssi

SCOP Domain Sequences for d1mkha_:

Sequence, based on SEQRES records: (download)

>d1mkha_ b.40.4.4 (A:) C-terminal domain of methionyl-tRNA synthetase, MetRS-CD {Archaeon Pyrococcus abyssi}
myvkfddfakldlrvgkiievkdhpnadklyvvkvdlgdevrtlvaglkkyykpeellnr
yvvvvanlepkklrgigsqgmllaaddgervallmpdkevklgakvr

Sequence, based on observed residues (ATOM records): (download)

>d1mkha_ b.40.4.4 (A:) C-terminal domain of methionyl-tRNA synthetase, MetRS-CD {Archaeon Pyrococcus abyssi}
myvkfddfakldlrvgkiievkdhpnadklyvvkvdlgdevrtlvaglkkyykpeellnr
yvvvvanlepkklgigsqgmllaaddgervallmpdkevklgakvr

SCOP Domain Coordinates for d1mkha_:

Click to download the PDB-style file with coordinates for d1mkha_.
(The format of our PDB-style files is described here.)

Timeline for d1mkha_: