Lineage for d1mkgd_ (1mkg D:)

  1. Root: SCOP 1.63
  2. 268577Class g: Small proteins [56992] (61 folds)
  3. 270434Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
    disulphide-rich fold; common core is all-beta
  4. 270435Superfamily g.17.1: Cystine-knot cytokines [57501] (7 families) (S)
  5. 270436Family g.17.1.1: Platelet-derived growth factor-like [57502] (3 proteins)
  6. 270446Protein Vascular endothelial growth factor, VEGF [57505] (1 species)
  7. 270447Species Human (Homo sapiens) [TaxId:9606] [57506] (11 PDB entries)
  8. 270481Domain d1mkgd_: 1mkg D: [79237]
    disulfide deficient mutant

Details for d1mkgd_

PDB Entry: 1mkg (more details), 2.5 Å

PDB Description: disulfide deficient mutant of vascular endothelial growth factor a (c57a and c102a)

SCOP Domain Sequences for d1mkgd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mkgd_ g.17.1.1 (D:) Vascular endothelial growth factor, VEGF {Human (Homo sapiens)}
vvkfmdvyqrsychpietlvdifqeypdeieyifkpscvplmraggccndeglecvptee
snitmqimrikphqgqhigemsflqhnkaecrpk

SCOP Domain Coordinates for d1mkgd_:

Click to download the PDB-style file with coordinates for d1mkgd_.
(The format of our PDB-style files is described here.)

Timeline for d1mkgd_: