Lineage for d1mkgd_ (1mkg D:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3033576Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
    disulfide-rich fold; common core is all-beta
  4. 3033577Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families) (S)
  5. 3033578Family g.17.1.1: Platelet-derived growth factor-like [57502] (4 proteins)
  6. 3033590Protein Vascular endothelial growth factor, VEGF [57505] (3 species)
  7. 3033593Species Human (Homo sapiens) [TaxId:9606] [57506] (22 PDB entries)
    Uniprot P15692 40-133
  8. 3033651Domain d1mkgd_: 1mkg D: [79237]
    disulfide deficient mutant
    mutant

Details for d1mkgd_

PDB Entry: 1mkg (more details), 2.5 Å

PDB Description: disulfide deficient mutant of vascular endothelial growth factor a (c57a and c102a)
PDB Compounds: (D:) Vascular Endothelial Growth Factor A

SCOPe Domain Sequences for d1mkgd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mkgd_ g.17.1.1 (D:) Vascular endothelial growth factor, VEGF {Human (Homo sapiens) [TaxId: 9606]}
vvkfmdvyqrsychpietlvdifqeypdeieyifkpscvplmraggccndeglecvptee
snitmqimrikphqgqhigemsflqhnkaecrpk

SCOPe Domain Coordinates for d1mkgd_:

Click to download the PDB-style file with coordinates for d1mkgd_.
(The format of our PDB-style files is described here.)

Timeline for d1mkgd_: