Lineage for d1mkgb_ (1mkg B:)

  1. Root: SCOPe 2.04
  2. 1700111Class g: Small proteins [56992] (91 folds)
  3. 1703391Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
    disulfide-rich fold; common core is all-beta
  4. 1703392Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families) (S)
  5. 1703393Family g.17.1.1: Platelet-derived growth factor-like [57502] (4 proteins)
  6. 1703405Protein Vascular endothelial growth factor, VEGF [57505] (3 species)
  7. 1703408Species Human (Homo sapiens) [TaxId:9606] [57506] (16 PDB entries)
    Uniprot P15692 40-133
  8. 1703453Domain d1mkgb_: 1mkg B: [79235]
    disulfide deficient mutant
    mutant

Details for d1mkgb_

PDB Entry: 1mkg (more details), 2.5 Å

PDB Description: disulfide deficient mutant of vascular endothelial growth factor a (c57a and c102a)
PDB Compounds: (B:) Vascular Endothelial Growth Factor A

SCOPe Domain Sequences for d1mkgb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mkgb_ g.17.1.1 (B:) Vascular endothelial growth factor, VEGF {Human (Homo sapiens) [TaxId: 9606]}
vvkfmdvyqrsychpietlvdifqeypdeieyifkpscvplmraggccndeglecvptee
snitmqimrikphqgqhigemsflqhnkaecrpk

SCOPe Domain Coordinates for d1mkgb_:

Click to download the PDB-style file with coordinates for d1mkgb_.
(The format of our PDB-style files is described here.)

Timeline for d1mkgb_: