Lineage for d1mkgb_ (1mkg B:)

  1. Root: SCOP 1.67
  2. 427008Class g: Small proteins [56992] (72 folds)
  3. 429052Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
    disulfide-rich fold; common core is all-beta
  4. 429053Superfamily g.17.1: Cystine-knot cytokines [57501] (7 families) (S)
  5. 429054Family g.17.1.1: Platelet-derived growth factor-like [57502] (3 proteins)
  6. 429066Protein Vascular endothelial growth factor, VEGF [57505] (1 species)
  7. 429067Species Human (Homo sapiens) [TaxId:9606] [57506] (11 PDB entries)
  8. 429099Domain d1mkgb_: 1mkg B: [79235]

Details for d1mkgb_

PDB Entry: 1mkg (more details), 2.5 Å

PDB Description: disulfide deficient mutant of vascular endothelial growth factor a (c57a and c102a)

SCOP Domain Sequences for d1mkgb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mkgb_ g.17.1.1 (B:) Vascular endothelial growth factor, VEGF {Human (Homo sapiens)}
vvkfmdvyqrsychpietlvdifqeypdeieyifkpscvplmraggccndeglecvptee
snitmqimrikphqgqhigemsflqhnkaecrpk

SCOP Domain Coordinates for d1mkgb_:

Click to download the PDB-style file with coordinates for d1mkgb_.
(The format of our PDB-style files is described here.)

Timeline for d1mkgb_: