Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.226: GIY-YIG endonuclease [82770] (1 superfamily) beta(2)-alpha(2)-beta-alpha-(beta); strand 4 is very short; 3 layers; antiparallel (mixed) beta-sheet; order 312(4) |
Superfamily d.226.1: GIY-YIG endonuclease [82771] (1 family) automatically mapped to Pfam PF01541 |
Family d.226.1.1: GIY-YIG endonuclease [82772] (1 protein) |
Protein Homing endonuclease I-TevI [82773] (1 species) intron-associated endonuclease 1 |
Species Bacteriophage T4 [TaxId:10665] [82774] (2 PDB entries) |
Domain d1mk0a_: 1mk0 A: [79216] complexed with bme, cit; mutant |
PDB Entry: 1mk0 (more details), 1.6 Å
SCOPe Domain Sequences for d1mk0a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mk0a_ d.226.1.1 (A:) Homing endonuclease I-TevI {Bacteriophage T4 [TaxId: 10665]} mksgiyqikntlnnkvyvgsakdfekrwkrhfkdlekgchssiklqrsfnkhgnvfecsi leeipyekdliieranfwikelnskingyniadatfg
Timeline for d1mk0a_: