Lineage for d1mk0a_ (1mk0 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3007837Fold d.226: GIY-YIG endonuclease [82770] (1 superfamily)
    beta(2)-alpha(2)-beta-alpha-(beta); strand 4 is very short; 3 layers; antiparallel (mixed) beta-sheet; order 312(4)
  4. 3007838Superfamily d.226.1: GIY-YIG endonuclease [82771] (1 family) (S)
    automatically mapped to Pfam PF01541
  5. 3007839Family d.226.1.1: GIY-YIG endonuclease [82772] (1 protein)
  6. 3007840Protein Homing endonuclease I-TevI [82773] (1 species)
    intron-associated endonuclease 1
  7. 3007841Species Bacteriophage T4 [TaxId:10665] [82774] (2 PDB entries)
  8. 3007842Domain d1mk0a_: 1mk0 A: [79216]
    complexed with bme, cit; mutant

Details for d1mk0a_

PDB Entry: 1mk0 (more details), 1.6 Å

PDB Description: catalytic domain of intron endonuclease i-tevi, e75a mutant
PDB Compounds: (A:) intron-associated endonuclease 1

SCOPe Domain Sequences for d1mk0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mk0a_ d.226.1.1 (A:) Homing endonuclease I-TevI {Bacteriophage T4 [TaxId: 10665]}
mksgiyqikntlnnkvyvgsakdfekrwkrhfkdlekgchssiklqrsfnkhgnvfecsi
leeipyekdliieranfwikelnskingyniadatfg

SCOPe Domain Coordinates for d1mk0a_:

Click to download the PDB-style file with coordinates for d1mk0a_.
(The format of our PDB-style files is described here.)

Timeline for d1mk0a_: