Lineage for d1mjvb_ (1mjv B:)

  1. Root: SCOPe 2.04
  2. 1700111Class g: Small proteins [56992] (91 folds)
  3. 1703391Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
    disulfide-rich fold; common core is all-beta
  4. 1703392Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families) (S)
  5. 1703393Family g.17.1.1: Platelet-derived growth factor-like [57502] (4 proteins)
  6. 1703405Protein Vascular endothelial growth factor, VEGF [57505] (3 species)
  7. 1703408Species Human (Homo sapiens) [TaxId:9606] [57506] (16 PDB entries)
    Uniprot P15692 40-133
  8. 1703451Domain d1mjvb_: 1mjv B: [79215]
    disulfide deficient mutant
    mutant

Details for d1mjvb_

PDB Entry: 1mjv (more details), 2.1 Å

PDB Description: disulfide deficient mutant of vascular endothelial growth factor a (c51a and c60a)
PDB Compounds: (B:) Vascular Endothelial Growth Factor A

SCOPe Domain Sequences for d1mjvb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mjvb_ g.17.1.1 (B:) Vascular endothelial growth factor, VEGF {Human (Homo sapiens) [TaxId: 9606]}
mvvkfmdvyqrsychpietlvdifqeypdeieyifkpsavplmrcggacndeglecvpte
esnitmqimrikphqgqhigemsflqhnkcecrpkk

SCOPe Domain Coordinates for d1mjvb_:

Click to download the PDB-style file with coordinates for d1mjvb_.
(The format of our PDB-style files is described here.)

Timeline for d1mjvb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1mjva_