Lineage for d1mjvb_ (1mjv B:)

  1. Root: SCOP 1.75
  2. 888632Class g: Small proteins [56992] (90 folds)
  3. 891138Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
    disulfide-rich fold; common core is all-beta
  4. 891139Superfamily g.17.1: Cystine-knot cytokines [57501] (7 families) (S)
  5. 891140Family g.17.1.1: Platelet-derived growth factor-like [57502] (3 proteins)
  6. 891152Protein Vascular endothelial growth factor, VEGF [57505] (3 species)
  7. 891155Species Human (Homo sapiens) [TaxId:9606] [57506] (16 PDB entries)
    Uniprot P15692 40-133
  8. 891200Domain d1mjvb_: 1mjv B: [79215]
    disulfide deficient mutant

Details for d1mjvb_

PDB Entry: 1mjv (more details), 2.1 Å

PDB Description: disulfide deficient mutant of vascular endothelial growth factor a (c51a and c60a)
PDB Compounds: (B:) Vascular Endothelial Growth Factor A

SCOP Domain Sequences for d1mjvb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mjvb_ g.17.1.1 (B:) Vascular endothelial growth factor, VEGF {Human (Homo sapiens) [TaxId: 9606]}
mvvkfmdvyqrsychpietlvdifqeypdeieyifkpsavplmrcggacndeglecvpte
esnitmqimrikphqgqhigemsflqhnkcecrpkk

SCOP Domain Coordinates for d1mjvb_:

Click to download the PDB-style file with coordinates for d1mjvb_.
(The format of our PDB-style files is described here.)

Timeline for d1mjvb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1mjva_