SCOP 1.75: Domain d1mjib_: 1mji B:

Lineage for d1mjib_ (1mji B:)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.77: RL5-like [55281] (1 superfamily)
   beta-alpha-beta(2)-alpha-beta(3)-alpha; 2 layers, alpha/beta; antiparallel beta-sheet: order 231654

4. Superfamily d.77.1: RL5-like [55282] (2 families)

5. Family d.77.1.1: Ribosomal protein L5 [55283] (1 protein)

6. Protein Ribosomal protein L5 [55284] (5 species)
   synonym: 50S ribosomal protein L5p, HMAL5, HL13

7. Species Thermus thermophilus [TaxId:274] [82718] (6 PDB entries)

8. Domain d1mjib_: 1mji B: [79209]
   complex with a 5S rRNA fragment
   complexed with k, mg, mse

Details for d1mjib_

PDB Entry: 1mji, 2.5 Å

PDB Description: detailed analysis of rna-protein interactions within the bacterial ribosomal protein l5/5s rrna complex

PDB Compounds: (B:) 50S ribosomal protein L5

SCOP Domain Sequences for d1mjib_:

Sequence; same for both SEQRES and ATOM records:

>d1mjib_ d.77.1.1 (B:) Ribosomal protein L5 {Thermus thermophilus [TaxId: 274]}
dvalkrkyyeevrpelirrfgyqnvwevprlekvvinqglgeakedarilekaaqelali
tgqkpavtrakksisnfklrkgmpiglrvtlrrdrmwiflekllnvalprirdfrglnpn
sfdgrgnynlglreqlifpeitydmvdalrgmdiavvttaetdeearallellgfpfrk

Timeline for d1mjib_:

• d1mjib_ first appeared in SCOP 1.63
  
• d1mjib_ appears in SCOP 1.73
  
• d1mjib_ appears in SCOPe 2.01
  
• d1mjib_ appears in the current release, SCOPe 2.08