Lineage for d1mjia_ (1mji A:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1209370Fold d.77: RL5-like [55281] (1 superfamily)
    beta-alpha-beta(2)-alpha-beta(3)-alpha; 2 layers, alpha/beta; antiparallel beta-sheet: order 231654
  4. 1209371Superfamily d.77.1: RL5-like [55282] (3 families) (S)
  5. 1209372Family d.77.1.1: Ribosomal protein L5 [55283] (1 protein)
  6. 1209373Protein Ribosomal protein L5 [55284] (5 species)
    synonym: 50S ribosomal protein L5p, HMAL5, HL13
  7. 1209455Species Thermus thermophilus [TaxId:274] [82718] (6 PDB entries)
  8. 1209456Domain d1mjia_: 1mji A: [79208]
    complex with a 5S rRNA fragment
    protein/RNA complex; complexed with k, mg

Details for d1mjia_

PDB Entry: 1mji (more details), 2.5 Å

PDB Description: detailed analysis of rna-protein interactions within the bacterial ribosomal protein l5/5s rrna complex
PDB Compounds: (A:) 50S ribosomal protein L5

SCOPe Domain Sequences for d1mjia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mjia_ d.77.1.1 (A:) Ribosomal protein L5 {Thermus thermophilus [TaxId: 274]}
ldvalkrkyyeevrpelirrfgyqnvwevprlekvvinqglgeakedarilekaaqelal
itgqkpavtrakksisnfklrkgmpiglrvtlrrdrmwiflekllnvalprirdfrglnp
nsfdgrgnynlglreqlifpeitydmvdalrgmdiavvttaetdeearallellgfpfrk

SCOPe Domain Coordinates for d1mjia_:

Click to download the PDB-style file with coordinates for d1mjia_.
(The format of our PDB-style files is described here.)

Timeline for d1mjia_: