Lineage for d1mjia_ (1mji A:)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 258857Fold d.77: Ribosomal protein L5 [55281] (1 superfamily)
    beta-alpha-beta(2)-alpha-beta(3)-alpha; 2 layers, alpha/beta; antiparallel beta-sheet: order 231654
  4. 258858Superfamily d.77.1: Ribosomal protein L5 [55282] (1 family) (S)
  5. 258859Family d.77.1.1: Ribosomal protein L5 [55283] (1 protein)
  6. 258860Protein Ribosomal protein L5 [55284] (3 species)
    synonym: 50S ribosomal protein L5p, HMAL5, HL13
  7. 258873Species Thermus thermophilus [TaxId:274] [82718] (1 PDB entry)
  8. 258874Domain d1mjia_: 1mji A: [79208]

Details for d1mjia_

PDB Entry: 1mji (more details), 2.5 Å

PDB Description: detailed analysis of rna-protein interactions within the bacterial ribosomal protein l5/5s rrna complex

SCOP Domain Sequences for d1mjia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mjia_ d.77.1.1 (A:) Ribosomal protein L5 {Thermus thermophilus}
ldvalkrkyyeevrpelirrfgyqnvwevprlekvvinqglgeakedarilekaaqelal
itgqkpavtrakksisnfklrkgmpiglrvtlrrdrmwiflekllnvalprirdfrglnp
nsfdgrgnynlglreqlifpeitydmvdalrgmdiavvttaetdeearallellgfpfrk

SCOP Domain Coordinates for d1mjia_:

Click to download the PDB-style file with coordinates for d1mjia_.
(The format of our PDB-style files is described here.)

Timeline for d1mjia_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1mjib_