Lineage for d1mjgp_ (1mjg P:)

  1. Root: SCOP 1.65
  2. 338536Class e: Multi-domain proteins (alpha and beta) [56572] (38 folds)
  3. 339855Fold e.26: Prismane protein-like [56820] (1 superfamily)
    3 domains: (1) spectrin repeat-like 3-helical bundle; (2 and 3) alpha/beta: Rossmann-fold topology
  4. 339856Superfamily e.26.1: Prismane protein-like [56821] (3 families) (S)
  5. 339891Family e.26.1.3: Bifunctional carbon monoxide dehydrogenase/acethyl-CoA synthase (CODH/ACS) alpha (ACS) subunit [82852] (1 protein)
    4 domains: structures and assembly of domains 1 and 2 are similar to those of domains 1 and 3 of the CODH subunit; (3 and 4) alpha+beta
  6. 339892Protein Bifunctional carbon monoxide dehydrogenase/acethyl-CoA synthase (CODH/ACS) alpha (ACS) subunit [82853] (1 species)
  7. 339893Species Moorella thermoacetica [TaxId:1525] [82854] (2 PDB entries)
  8. 339899Domain d1mjgp_: 1mjg P: [79207]
    Other proteins in same PDB: d1mjga_, d1mjgb_, d1mjgc_, d1mjgd_
    complexed with act, cu1, fs4, ni, xcc

Details for d1mjgp_

PDB Entry: 1mjg (more details), 2.2 Å

PDB Description: crystal structure of bifunctional carbon monoxide dehydrogenase/acetyl-coa synthase(codh/acs) from moorella thermoacetica (f. clostridium thermoaceticum)

SCOP Domain Sequences for d1mjgp_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mjgp_ e.26.1.3 (P:) Bifunctional carbon monoxide dehydrogenase/acethyl-CoA synthase (CODH/ACS) alpha (ACS) subunit {Moorella thermoacetica}
tdfdkifegaipegkepvalfrevyhgaitatsyaeillnqairtygpdhpvgypdtayy
lpvircfsgeevkklgdlppilnrkraqvspvlnfenarlageatwyaaeiiealrylky
kpdepllpppwtgfigdpvvrrfgikmvdwtipgeaiilgrakdskalakivkelmgmgf
mlficdeaveqlleenvklgidyiayplgnftqivhaanyalragmmfggvtpgareeqr
dyqrrrirafvlylgehdmvktaaafgaiftgfpvitdqplpedkqipdwffsvedydki
vqiametrgikltkikldlpinfgpafegesirkgdmyvemggnrtpafelvrtvsesei
tdgkievigpdidqipegsklplgilvdiygrkmqadfegvlerrihdfinygeglwhtg
qrninwlrvskdavakgfrfknygeilvakmkeefpaivdrvqvtiftdeakvkeymeva
rekykerddrmrgltdetvdtfyscvlcqsfapnhvcivtpervglcgavswldakasye
inhagpnqpipkegeidpikgiwksvndylytasnrnleqvclytlmenpmtscgcfeai
mailpecngimittrdhagmtpsgmtfstlagmigggtqtpgfmgigrtyivskkfisad
ggiarivwmpkslkdflhdefvrssveeglgedfidkiadetigttvdeilpyleekghp
altmdpim

SCOP Domain Coordinates for d1mjgp_:

Click to download the PDB-style file with coordinates for d1mjgp_.
(The format of our PDB-style files is described here.)

Timeline for d1mjgp_: