Lineage for d1mjgn_ (1mjg N:)

  1. Root: SCOPe 2.07
  2. 2568173Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2574099Fold e.26: Prismane protein-like [56820] (1 superfamily)
    3 domains: (1) spectrin repeat-like 3-helical bundle; (2 and 3) alpha/beta: Rossmann-fold topology
  4. 2574100Superfamily e.26.1: Prismane protein-like [56821] (4 families) (S)
  5. 2574168Family e.26.1.3: Acetyl-CoA synthase [82852] (3 proteins)
    4 domains: structures and assembly of domains 1 and 2 are similar to those of domains 1 and 3 of the CODH subunit; (3 and 4) alpha+beta
  6. 2574169Protein Bifunctional carbon monoxide dehydrogenase/acetyl-CoA synthase (CODH/ACS) alpha (ACS) subunit [82853] (1 species)
  7. 2574170Species Moorella thermoacetica [TaxId:1525] [82854] (2 PDB entries)
  8. 2574174Domain d1mjgn_: 1mjg N: [79205]
    Other proteins in same PDB: d1mjga_, d1mjgb_, d1mjgc_, d1mjgd_
    complexed with act, cu1, ni, sf4, xcc

Details for d1mjgn_

PDB Entry: 1mjg (more details), 2.2 Å

PDB Description: crystal structure of bifunctional carbon monoxide dehydrogenase/acetyl-coa synthase(codh/acs) from moorella thermoacetica (f. clostridium thermoaceticum)
PDB Compounds: (N:) Carbon monoxide dehydrogenase alpha subunit

SCOPe Domain Sequences for d1mjgn_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mjgn_ e.26.1.3 (N:) Bifunctional carbon monoxide dehydrogenase/acetyl-CoA synthase (CODH/ACS) alpha (ACS) subunit {Moorella thermoacetica [TaxId: 1525]}
tdfdkifegaipegkepvalfrevyhgaitatsyaeillnqairtygpdhpvgypdtayy
lpvircfsgeevkklgdlppilnrkraqvspvlnfenarlageatwyaaeiiealrylky
kpdepllpppwtgfigdpvvrrfgikmvdwtipgeaiilgrakdskalakivkelmgmgf
mlficdeaveqlleenvklgidyiayplgnftqivhaanyalragmmfggvtpgareeqr
dyqrrrirafvlylgehdmvktaaafgaiftgfpvitdqplpedkqipdwffsvedydki
vqiametrgikltkikldlpinfgpafegesirkgdmyvemggnrtpafelvrtvsesei
tdgkievigpdidqipegsklplgilvdiygrkmqadfegvlerrihdfinygeglwhtg
qrninwlrvskdavakgfrfknygeilvakmkeefpaivdrvqvtiftdeakvkeymeva
rekykerddrmrgltdetvdtfyscvlcqsfapnhvcivtpervglcgavswldakasye
inhagpnqpipkegeidpikgiwksvndylytasnrnleqvclytlmenpmtscgcfeai
mailpecngimittrdhagmtpsgmtfstlagmigggtqtpgfmgigrtyivskkfisad
ggiarivwmpkslkdflhdefvrssveeglgedfidkiadetigttvdeilpyleekghp
altmdpim

SCOPe Domain Coordinates for d1mjgn_:

Click to download the PDB-style file with coordinates for d1mjgn_.
(The format of our PDB-style files is described here.)

Timeline for d1mjgn_: