Lineage for d1mjgc_ (1mjg C:)

  1. Root: SCOPe 2.07
  2. 2568173Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2574099Fold e.26: Prismane protein-like [56820] (1 superfamily)
    3 domains: (1) spectrin repeat-like 3-helical bundle; (2 and 3) alpha/beta: Rossmann-fold topology
  4. 2574100Superfamily e.26.1: Prismane protein-like [56821] (4 families) (S)
  5. 2574121Family e.26.1.2: Carbon monoxide dehydrogenase [64514] (3 proteins)
    automatically mapped to Pfam PF03063
  6. 2574122Protein Bifunctional carbon monoxide dehydrogenase/acetyl-CoA synthase (CODH/ACS) beta (CODH) subunit [82850] (1 species)
  7. 2574123Species Moorella thermoacetica [TaxId:1525] [82851] (2 PDB entries)
  8. 2574128Domain d1mjgc_: 1mjg C: [79202]
    Other proteins in same PDB: d1mjgm_, d1mjgn_, d1mjgo_, d1mjgp_
    complexed with act, cu1, ni, sf4, xcc

Details for d1mjgc_

PDB Entry: 1mjg (more details), 2.2 Å

PDB Description: crystal structure of bifunctional carbon monoxide dehydrogenase/acetyl-coa synthase(codh/acs) from moorella thermoacetica (f. clostridium thermoaceticum)
PDB Compounds: (C:) carbon monoxide dehydrogenase beta subunit

SCOPe Domain Sequences for d1mjgc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mjgc_ e.26.1.2 (C:) Bifunctional carbon monoxide dehydrogenase/acetyl-CoA synthase (CODH/ACS) beta (CODH) subunit {Moorella thermoacetica [TaxId: 1525]}
rfrdlshncrpseaprvmepknrdrtvdpavlemlvkskddkvitafdrfvaqqpqckig
yegiccrfcmagpcrikatdgpgsrgicgasawtivarnvglmiltgaaahcehgnhiah
alvemaegkapdysvkdeaklkevcrrvgievegksvlelaqevgekaledfrrlkgege
atwlmttinegrkekfrthnvvpfgihasiselvnqahmgmdndpvnlvfsairvalady
tgehiatdfsdilfgtpqpvvseanmgvldpdqvnfvlhghnpllseiivqaaremegea
kaagakginlvgicctgnevlmrqgiplvtsfasqelaictgaidamcvdvqcimpsisa
vaecyhtriittadnakipgayhidyqtataiesaktairmaieafkerkesnrpvyipq
iknrvvagwslealtkllatqnaqnpirvlnqaildgelagvalicgcnnlkgfqdnshl
tvmkellknnvfvvatgcsaqaagklglldpanvetycgdglkgflkrlgeganieiglp
pvfhmgscvdnsravdllmamandlgvdtpkvpfvasapeamsgkaaaigtwwvslgvpt
hvgtmppvegsdliysiltqiasdvyggyfifemdpqvaarkildaleyrtwklgvhkev
aeryetklcqgy

SCOPe Domain Coordinates for d1mjgc_:

Click to download the PDB-style file with coordinates for d1mjgc_.
(The format of our PDB-style files is described here.)

Timeline for d1mjgc_: