Lineage for d1mjgb_ (1mjg B:)

  1. Root: SCOP 1.65
  2. 338536Class e: Multi-domain proteins (alpha and beta) [56572] (38 folds)
  3. 339855Fold e.26: Prismane protein-like [56820] (1 superfamily)
    3 domains: (1) spectrin repeat-like 3-helical bundle; (2 and 3) alpha/beta: Rossmann-fold topology
  4. 339856Superfamily e.26.1: Prismane protein-like [56821] (3 families) (S)
  5. 339872Family e.26.1.2: Carbon monoxide dehydrogenase [64514] (2 proteins)
  6. 339873Protein Bifunctional carbon monoxide dehydrogenase/acethyl-CoA synthase (CODH/ACS) beta (CODH) subunit [82850] (1 species)
  7. 339874Species Moorella thermoacetica [TaxId:1525] [82851] (2 PDB entries)
  8. 339878Domain d1mjgb_: 1mjg B: [79201]
    Other proteins in same PDB: d1mjgm_, d1mjgn_, d1mjgo_, d1mjgp_

Details for d1mjgb_

PDB Entry: 1mjg (more details), 2.2 Å

PDB Description: crystal structure of bifunctional carbon monoxide dehydrogenase/acetyl-coa synthase(codh/acs) from moorella thermoacetica (f. clostridium thermoaceticum)

SCOP Domain Sequences for d1mjgb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mjgb_ e.26.1.2 (B:) Bifunctional carbon monoxide dehydrogenase/acethyl-CoA synthase (CODH/ACS) beta (CODH) subunit {Moorella thermoacetica}
rfrdlshncrpseaprvmepknrdrtvdpavlemlvkskddkvitafdrfvaqqpqckig
yegiccrfcmagpcrikatdgpgsrgicgasawtivarnvglmiltgaaahcehgnhiah
alvemaegkapdysvkdeaklkevcrrvgievegksvlelaqevgekaledfrrlkgege
atwlmttinegrkekfrthnvvpfgihasiselvnqahmgmdndpvnlvfsairvalady
tgehiatdfsdilfgtpqpvvseanmgvldpdqvnfvlhghnpllseiivqaaremegea
kaagakginlvgicctgnevlmrqgiplvtsfasqelaictgaidamcvdvqcimpsisa
vaecyhtriittadnakipgayhidyqtataiesaktairmaieafkerkesnrpvyipq
iknrvvagwslealtkllatqnaqnpirvlnqaildgelagvalicgcnnlkgfqdnshl
tvmkellknnvfvvatgcsaqaagklglldpanvetycgdglkgflkrlgeganieiglp
pvfhmgscvdnsravdllmamandlgvdtpkvpfvasapeamsgkaaaigtwwvslgvpt
hvgtmppvegsdliysiltqiasdvyggyfifemdpqvaarkildaleyrtwklgvhkev
aeryetklcqgy

SCOP Domain Coordinates for d1mjgb_:

Click to download the PDB-style file with coordinates for d1mjgb_.
(The format of our PDB-style files is described here.)

Timeline for d1mjgb_: