SCOP 1.63: Domain d1miyb2: 1miy B:1-139

Lineage for d1miyb2 (1miy B:1-139)

1. Root: SCOP 1.63

2. Class d: Alpha and beta proteins (a+b) [53931] (224 folds)

3. Fold d.218: Nucleotidyltransferase [81302] (1 superfamily)
   core: alpha-beta-turn-beta-X-beta-(alpha); mixed beta-sheet, order of core strands: 123

4. Superfamily d.218.1: Nucleotidyltransferase [81301] (4 families)

5. Family d.218.1.4: tRNA CCA-adding enzyme, head domain [82661] (1 protein)
   insert X in the core is an alpha-beta(2) unit; contains two extra C-terminal strands; mixed 7-stranded sheet, order: 7612543

6. Protein tRNA CCA-adding enzyme, head domain [82662] (1 species)

7. Species Bacillus stearothermophilus [TaxId:1422] [82663] (3 PDB entries)

8. Domain d1miyb2: 1miy B:1-139 [79171]
   Other proteins in same PDB: d1miya1, d1miyb1
   complexed with ctp, mg

Details for d1miyb2

PDB Entry: 1miy, 3.52 Å

PDB Description: Crystal structure of Bacillus stearothermophilus CCA-adding enzyme in complex with CTP

SCOP Domain Sequences for d1miyb2:

Sequence, based on SEQRES records:

>d1miyb2 d.218.1.4 (B:1-139) tRNA CCA-adding enzyme, head domain {Bacillus stearothermophilus}
mkppfqealgiiqqlkqhgydayfvggavrdlllgrpigdvdiatsalpedvmaifpkti
dvgskhgtvvvvhkgkayevttfktdgdyedyrrpesvtfvrsleedlkrrdftmnaiam
deygtiidpfggreairrr

Sequence, based on observed residues (ATOM records):

>d1miyb2 d.218.1.4 (B:1-139) tRNA CCA-adding enzyme, head domain {Bacillus stearothermophilus}
mkppfqealgiiqqlkqhgydayfvggavrdlllgrpigdvdiatsalpedvmaifpkti
dvgskhgtvvvvhkgkayevttfktdgsvtfvrsleedlkrrdftmnaiamdeygtiidp
fggreairrr

Timeline for d1miyb2:

• d1miyb2 is new in SCOP 1.63
  
• d1miyb2 appears in SCOP 1.65
  
• d1miyb2 appears in the current release, SCOPe 2.08