| Class a: All alpha proteins [46456] (289 folds) |
| Fold a.173: Poly A polymerase C-terminal region-like [81890] (1 superfamily) multihelical; can be divided into three subdomains (neck, body and tail) |
Superfamily a.173.1: Poly A polymerase C-terminal region-like [81891] (1 family) ![]() the neck subdomain is an alpha-alpha superhelix; the tail subdomain is similar to the RuvA C-terminal domain-like |
| Family a.173.1.1: Poly A polymerase C-terminal region-like [81892] (2 proteins) the 'neck' domain corresponds to the C-terminal part of Pfam PF01743 |
| Protein tRNA CCA-adding enzyme, C-terminal domains [81893] (2 species) |
| Species Bacillus stearothermophilus [TaxId:1422] [81894] (3 PDB entries) |
| Domain d1miyb1: 1miy B:140-404 [79170] Other proteins in same PDB: d1miya2, d1miyb2 protein/RNA complex; complexed with ctp, mg |
PDB Entry: 1miy (more details), 3.52 Å
SCOPe Domain Sequences for d1miyb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1miyb1 a.173.1.1 (B:140-404) tRNA CCA-adding enzyme, C-terminal domains {Bacillus stearothermophilus [TaxId: 1422]}
iirtvgeaekrfredalrmmravrfvselgfalapdteqaivqnapllahisvermtmem
ekllggpfaaralpllaetglnaylpglagkekqlrlaaayrwpwlaareerwallchal
gvqesrpflrawklpnkvvdeagailtaladiprpeawtneqlfsagleralsvetvraa
ftgappgpwheklrrrfaslpiktkgelavngkdviewvgkpagpwvkealdaiwravvn
gevenekeriyawlmernrtreknc
Timeline for d1miyb1: