Class a: All alpha proteins [46456] (171 folds) |
Fold a.173: tRNA CCA-adding enzyme, C-terminal domains [81890] (1 superfamily) multihelical; can be divided into three subdomains (neck, body and tail) |
Superfamily a.173.1: tRNA CCA-adding enzyme, C-terminal domains [81891] (1 family) the neck subdomain is an alpha-alpha superhelix; the tail subdomain is similar to the RuvA C-terminal domain-like |
Family a.173.1.1: tRNA CCA-adding enzyme, C-terminal domains [81892] (1 protein) |
Protein tRNA CCA-adding enzyme, C-terminal domains [81893] (1 species) |
Species Bacillus stearothermophilus [TaxId:1422] [81894] (3 PDB entries) |
Domain d1miyb1: 1miy B:140-404 [79170] Other proteins in same PDB: d1miya2, d1miyb2 complexed with ctp, mg |
PDB Entry: 1miy (more details), 3.52 Å
SCOP Domain Sequences for d1miyb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1miyb1 a.173.1.1 (B:140-404) tRNA CCA-adding enzyme, C-terminal domains {Bacillus stearothermophilus} iirtvgeaekrfredalrmmravrfvselgfalapdteqaivqnapllahisvermtmem ekllggpfaaralpllaetglnaylpglagkekqlrlaaayrwpwlaareerwallchal gvqesrpflrawklpnkvvdeagailtaladiprpeawtneqlfsagleralsvetvraa ftgappgpwheklrrrfaslpiktkgelavngkdviewvgkpagpwvkealdaiwravvn gevenekeriyawlmernrtreknc
Timeline for d1miyb1: