SCOPe 2.08: Domain d1miyb1: 1miy B:140-404

Lineage for d1miyb1 (1miy B:140-404)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.173: Poly A polymerase C-terminal region-like [81890] (1 superfamily)
   multihelical; can be divided into three subdomains (neck, body and tail)

4. Superfamily a.173.1: Poly A polymerase C-terminal region-like [81891] (1 family)
   the neck subdomain is an alpha-alpha superhelix; the tail subdomain is similar to the RuvA C-terminal domain-like

5. Family a.173.1.1: Poly A polymerase C-terminal region-like [81892] (2 proteins)
   the 'neck' domain corresponds to the C-terminal part of Pfam PF01743

6. Protein tRNA CCA-adding enzyme, C-terminal domains [81893] (2 species)

7. Species Bacillus stearothermophilus [TaxId:1422] [81894] (3 PDB entries)

8. Domain d1miyb1: 1miy B:140-404 [79170]
   Other proteins in same PDB: d1miya2, d1miyb2
   protein/RNA complex; complexed with ctp, mg

Details for d1miyb1

PDB Entry: 1miy, 3.52 Å

PDB Description: Crystal structure of Bacillus stearothermophilus CCA-adding enzyme in complex with CTP

PDB Compounds: (B:) tRNA CCA-adding enzyme

SCOPe Domain Sequences for d1miyb1:

Sequence; same for both SEQRES and ATOM records:

>d1miyb1 a.173.1.1 (B:140-404) tRNA CCA-adding enzyme, C-terminal domains {Bacillus stearothermophilus [TaxId: 1422]}
iirtvgeaekrfredalrmmravrfvselgfalapdteqaivqnapllahisvermtmem
ekllggpfaaralpllaetglnaylpglagkekqlrlaaayrwpwlaareerwallchal
gvqesrpflrawklpnkvvdeagailtaladiprpeawtneqlfsagleralsvetvraa
ftgappgpwheklrrrfaslpiktkgelavngkdviewvgkpagpwvkealdaiwravvn
gevenekeriyawlmernrtreknc

Timeline for d1miyb1:

• d1miyb1 first appeared in SCOP 1.63
  
• d1miyb1 appears in SCOPe 2.07