Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.218: Nucleotidyltransferase [81302] (1 superfamily) core: alpha-beta-turn-beta-X-beta-(alpha); mixed beta-sheet, order of core strands: 123 |
Superfamily d.218.1: Nucleotidyltransferase [81301] (16 families) |
Family d.218.1.4: Poly A polymerase head domain-like [82661] (2 proteins) overlaps with the N-terminal part of Pfam PF01743; this family is distinct from eukaryotic PAPs insert X in the core is an alpha-beta(2) unit; contains two extra C-terminal strands; mixed 7-stranded sheet, order: 7612543 |
Protein tRNA CCA-adding enzyme, head domain [82662] (2 species) |
Species Bacillus stearothermophilus [TaxId:1422] [82663] (3 PDB entries) |
Domain d1miya2: 1miy A:1-139 [79169] Other proteins in same PDB: d1miya1, d1miyb1 protein/RNA complex; complexed with ctp, mg |
PDB Entry: 1miy (more details), 3.52 Å
SCOPe Domain Sequences for d1miya2:
Sequence, based on SEQRES records: (download)
>d1miya2 d.218.1.4 (A:1-139) tRNA CCA-adding enzyme, head domain {Bacillus stearothermophilus [TaxId: 1422]} mkppfqealgiiqqlkqhgydayfvggavrdlllgrpigdvdiatsalpedvmaifpkti dvgskhgtvvvvhkgkayevttfktdgdyedyrrpesvtfvrsleedlkrrdftmnaiam deygtiidpfggreairrr
>d1miya2 d.218.1.4 (A:1-139) tRNA CCA-adding enzyme, head domain {Bacillus stearothermophilus [TaxId: 1422]} mkppfqealgiiqqlkqhgydayfvggavrdlllgrpigdvdiatsalpedvmaifpkti dvgskhgtvvvvhkgkayevttfktdgsvtfvrsleedlkrrdftmnaiamdeygtiidp fggreairrr
Timeline for d1miya2: