Lineage for d1miwa1 (1miw A:140-404)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2348878Fold a.173: Poly A polymerase C-terminal region-like [81890] (1 superfamily)
    multihelical; can be divided into three subdomains (neck, body and tail)
  4. 2348879Superfamily a.173.1: Poly A polymerase C-terminal region-like [81891] (1 family) (S)
    the neck subdomain is an alpha-alpha superhelix; the tail subdomain is similar to the RuvA C-terminal domain-like
  5. 2348880Family a.173.1.1: Poly A polymerase C-terminal region-like [81892] (2 proteins)
    the 'neck' domain corresponds to the C-terminal part of Pfam PF01743
  6. 2348885Protein tRNA CCA-adding enzyme, C-terminal domains [81893] (2 species)
  7. 2348886Species Bacillus stearothermophilus [TaxId:1422] [81894] (3 PDB entries)
  8. 2348887Domain d1miwa1: 1miw A:140-404 [79162]
    Other proteins in same PDB: d1miwa2, d1miwb2
    protein/RNA complex; complexed with atp, mg

Details for d1miwa1

PDB Entry: 1miw (more details), 3 Å

PDB Description: Crystal structure of Bacillus stearothermophilus CCA-adding enzyme in complex with ATP
PDB Compounds: (A:) tRNA CCA-adding enzyme

SCOPe Domain Sequences for d1miwa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1miwa1 a.173.1.1 (A:140-404) tRNA CCA-adding enzyme, C-terminal domains {Bacillus stearothermophilus [TaxId: 1422]}
iirtvgeaekrfredalrmmravrfvselgfalapdteqaivqnapllahisvermtmem
ekllggpfaaralpllaetglnaylpglagkekqlrlaaayrwpwlaareerwallchal
gvqesrpflrawklpnkvvdeagailtaladiprpeawtneqlfsagleralsvetvraa
ftgappgpwheklrrrfaslpiktkgelavngkdviewvgkpagpwvkealdaiwravvn
gevenekeriyawlmernrtreknc

SCOPe Domain Coordinates for d1miwa1:

Click to download the PDB-style file with coordinates for d1miwa1.
(The format of our PDB-style files is described here.)

Timeline for d1miwa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1miwa2