| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.218: Nucleotidyltransferase [81302] (1 superfamily) core: alpha-beta-turn-beta-X-beta-(alpha); mixed beta-sheet, order of core strands: 123 |
Superfamily d.218.1: Nucleotidyltransferase [81301] (16 families) ![]() |
| Family d.218.1.4: Poly A polymerase head domain-like [82661] (2 proteins) overlaps with the N-terminal part of Pfam PF01743; this family is distinct from eukaryotic PAPs insert X in the core is an alpha-beta(2) unit; contains two extra C-terminal strands; mixed 7-stranded sheet, order: 7612543 |
| Protein tRNA CCA-adding enzyme, head domain [82662] (2 species) |
| Species Bacillus stearothermophilus [TaxId:1422] [82663] (3 PDB entries) |
| Domain d1mivb2: 1miv B:1-139 [79161] Other proteins in same PDB: d1miva1, d1mivb1 complexed with mg |
PDB Entry: 1miv (more details), 3.5 Å
SCOPe Domain Sequences for d1mivb2:
Sequence, based on SEQRES records: (download)
>d1mivb2 d.218.1.4 (B:1-139) tRNA CCA-adding enzyme, head domain {Bacillus stearothermophilus [TaxId: 1422]}
mkppfqealgiiqqlkqhgydayfvggavrdlllgrpigdvdiatsalpedvmaifpkti
dvgskhgtvvvvhkgkayevttfktdgdyedyrrpesvtfvrsleedlkrrdftmnaiam
deygtiidpfggreairrr
>d1mivb2 d.218.1.4 (B:1-139) tRNA CCA-adding enzyme, head domain {Bacillus stearothermophilus [TaxId: 1422]}
mkppfqealgiiqqlkqhgydayfvggavrdlllgrpigdvdiatsalpedvmaifpkti
dvgskhgtvvvvhkgkayevttfktdgsvtfvrsleedlkrrdftmnaiamdeygtiidp
fggreairrr
Timeline for d1mivb2: