SCOPe 2.08: Domain d1mivb2: 1miv B:1-139

Lineage for d1mivb2 (1miv B:1-139)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.218: Nucleotidyltransferase [81302] (1 superfamily)
   core: alpha-beta-turn-beta-X-beta-(alpha); mixed beta-sheet, order of core strands: 123

4. Superfamily d.218.1: Nucleotidyltransferase [81301] (16 families)

5. Family d.218.1.4: Poly A polymerase head domain-like [82661] (2 proteins)
   overlaps with the N-terminal part of Pfam PF01743; this family is distinct from eukaryotic PAPs
   insert X in the core is an alpha-beta(2) unit; contains two extra C-terminal strands; mixed 7-stranded sheet, order: 7612543

6. Protein tRNA CCA-adding enzyme, head domain [82662] (2 species)

7. Species Bacillus stearothermophilus [TaxId:1422] [82663] (3 PDB entries)

8. Domain d1mivb2: 1miv B:1-139 [79161]
   Other proteins in same PDB: d1miva1, d1mivb1
   complexed with mg

Details for d1mivb2

PDB Entry: 1miv, 3.5 Å

PDB Description: Crystal structure of Bacillus stearothermophilus CCA-adding enzyme

PDB Compounds: (B:) tRNA CCA-adding enzyme

SCOPe Domain Sequences for d1mivb2:

Sequence, based on SEQRES records:

>d1mivb2 d.218.1.4 (B:1-139) tRNA CCA-adding enzyme, head domain {Bacillus stearothermophilus [TaxId: 1422]}
mkppfqealgiiqqlkqhgydayfvggavrdlllgrpigdvdiatsalpedvmaifpkti
dvgskhgtvvvvhkgkayevttfktdgdyedyrrpesvtfvrsleedlkrrdftmnaiam
deygtiidpfggreairrr

Sequence, based on observed residues (ATOM records):

>d1mivb2 d.218.1.4 (B:1-139) tRNA CCA-adding enzyme, head domain {Bacillus stearothermophilus [TaxId: 1422]}
mkppfqealgiiqqlkqhgydayfvggavrdlllgrpigdvdiatsalpedvmaifpkti
dvgskhgtvvvvhkgkayevttfktdgsvtfvrsleedlkrrdftmnaiamdeygtiidp
fggreairrr

Timeline for d1mivb2:

• d1mivb2 first appeared in SCOP 1.63
  
• d1mivb2 appears in SCOPe 2.07