Lineage for d1mivb1 (1miv B:140-404)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 286973Fold a.173: tRNA CCA-adding enzyme, C-terminal domains [81890] (1 superfamily)
    multihelical; can be divided into three subdomains (neck, body and tail)
  4. 286974Superfamily a.173.1: tRNA CCA-adding enzyme, C-terminal domains [81891] (1 family) (S)
    the neck subdomain is an alpha-alpha superhelix; the tail subdomain is similar to the RuvA C-terminal domain-like
  5. 286975Family a.173.1.1: tRNA CCA-adding enzyme, C-terminal domains [81892] (1 protein)
  6. 286976Protein tRNA CCA-adding enzyme, C-terminal domains [81893] (2 species)
  7. 286977Species Bacillus stearothermophilus [TaxId:1422] [81894] (3 PDB entries)
  8. 286981Domain d1mivb1: 1miv B:140-404 [79160]
    Other proteins in same PDB: d1miva2, d1mivb2
    complexed with mg, mse

Details for d1mivb1

PDB Entry: 1miv (more details), 3.5 Å

PDB Description: Crystal structure of Bacillus stearothermophilus CCA-adding enzyme

SCOP Domain Sequences for d1mivb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mivb1 a.173.1.1 (B:140-404) tRNA CCA-adding enzyme, C-terminal domains {Bacillus stearothermophilus}
iirtvgeaekrfredalrmmravrfvselgfalapdteqaivqnapllahisvermtmem
ekllggpfaaralpllaetglnaylpglagkekqlrlaaayrwpwlaareerwallchal
gvqesrpflrawklpnkvvdeagailtaladiprpeawtneqlfsagleralsvetvraa
ftgappgpwheklrrrfaslpiktkgelavngkdviewvgkpagpwvkealdaiwravvn
gevenekeriyawlmernrtreknc

SCOP Domain Coordinates for d1mivb1:

Click to download the PDB-style file with coordinates for d1mivb1.
(The format of our PDB-style files is described here.)

Timeline for d1mivb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1mivb2