Lineage for d1mi6a_ (1mi6 A:)

  1. Root: SCOPe 2.01
  2. 1069520Class i: Low resolution protein structures [58117] (25 folds)
  3. 1069521Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 1069522Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 1069523Family i.1.1.1: Ribosome complexes [58120] (1 protein)
  6. 1069524Protein 70S ribosome functional complex [58121] (9 species)
  7. 1069596Species Escherichia coli [TaxId:562] [58123] (72 PDB entries)
  8. 1069666Domain d1mi6a_: 1mi6 A: [79149]
    Docking of the modified RF2 x-ray structure

Details for d1mi6a_

PDB Entry: 1mi6 (more details), 10.9 Å

PDB Description: docking of the modified rf2 x-ray structure into the low resolution cryo-em map of rf2 e.coli 70s ribosome
PDB Compounds: (A:) peptide chain release factor RF-2

SCOPe Domain Sequences for d1mi6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mi6a_ i.1.1.1 (A:) 70S ribosome functional complex {Escherichia coli [TaxId: 562]}
inpvnnriqdltersdvlrgyldydakkerleevnaeleqpdvwneperaqalgkerssl
eavvdtldqmkqgledvsgllelaveaddeetfneavaeldaleeklaqlefrrmfsgey
dsadcyldiqagsggteaqdwasmlermylrwaesrgfkteiieesegevagiksvtiki
sgdyaygwlrtetgvhrlvrkspfdsggrrhtsfssafvypevdddidieinpadlridv
yrasgaggqhvnrtesavrithiptgivtqcqndrsqhknkdqamkqmkaklyevemqkk
naekqamednksdigwgsqirsyvlddsrikdlrtgvetrntqavldgsldqfieaslka
gl

SCOPe Domain Coordinates for d1mi6a_:

Click to download the PDB-style file with coordinates for d1mi6a_.
(The format of our PDB-style files is described here.)

Timeline for d1mi6a_: