Lineage for d1mi5e2 (1mi5 E:119-247)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 929300Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 931881Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 935079Protein T-cell antigen receptor [49125] (6 species)
  7. 935105Species Human (Homo sapiens), beta-chain [TaxId:9606] [49129] (28 PDB entries)
  8. 935120Domain d1mi5e2: 1mi5 E:119-247 [79148]
    Other proteins in same PDB: d1mi5a1, d1mi5a2, d1mi5b_, d1mi5d1, d1mi5e1
    LC13 clone

Details for d1mi5e2

PDB Entry: 1mi5 (more details), 2.5 Å

PDB Description: The crystal structure of LC13 TcR in complex with HLAB8-EBV peptide complex
PDB Compounds: (E:) TCR beta chain

SCOPe Domain Sequences for d1mi5e2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mi5e2 b.1.1.2 (E:119-247) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]}
dlknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvstdpq
plkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqiv
saeawgrad

SCOPe Domain Coordinates for d1mi5e2:

Click to download the PDB-style file with coordinates for d1mi5e2.
(The format of our PDB-style files is described here.)

Timeline for d1mi5e2: