Lineage for d1mi5e1 (1mi5 E:3-118)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 929300Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 929301Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 931485Protein T-cell antigen receptor [48933] (6 species)
    sequences may differ within each classified species
  7. 931508Species Human (Homo sapiens), beta-chain [TaxId:9606] [48937] (30 PDB entries)
  8. 931525Domain d1mi5e1: 1mi5 E:3-118 [79147]
    Other proteins in same PDB: d1mi5a1, d1mi5a2, d1mi5b_, d1mi5d2, d1mi5e2
    LC13 clone

Details for d1mi5e1

PDB Entry: 1mi5 (more details), 2.5 Å

PDB Description: The crystal structure of LC13 TcR in complex with HLAB8-EBV peptide complex
PDB Compounds: (E:) TCR beta chain

SCOPe Domain Sequences for d1mi5e1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mi5e1 b.1.1.1 (E:3-118) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]}
gvsqsprykvakrgqdvalrcdpisghvslfwyqqalgqgpefltyfqneaqldksglps
drffaerpegsvstlkiqrtqqedsavylcasslgqayeqyfgpgtrltvte

SCOPe Domain Coordinates for d1mi5e1:

Click to download the PDB-style file with coordinates for d1mi5e1.
(The format of our PDB-style files is described here.)

Timeline for d1mi5e1: