Lineage for d1mi5d2 (1mi5 D:118-206)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 220405Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 221982Protein T-cell antigen receptor [49125] (6 species)
  7. 221983Species Human (Homo sapiens), alpha-chain [TaxId:9606] [49127] (8 PDB entries)
  8. 221985Domain d1mi5d2: 1mi5 D:118-206 [79146]
    Other proteins in same PDB: d1mi5a1, d1mi5a2, d1mi5b_, d1mi5d1, d1mi5e1
    LC13 clone

Details for d1mi5d2

PDB Entry: 1mi5 (more details), 2.5 Å

PDB Description: The crystal structure of LC13 TcR in complex with HLAB8-EBV peptide complex

SCOP Domain Sequences for d1mi5d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mi5d2 b.1.1.2 (D:118-206) T-cell antigen receptor {Human (Homo sapiens), alpha-chain}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdktvldmrsmdfksns
avawsnksdfacanafnnsiipedtffps

SCOP Domain Coordinates for d1mi5d2:

Click to download the PDB-style file with coordinates for d1mi5d2.
(The format of our PDB-style files is described here.)

Timeline for d1mi5d2: