SCOP 1.69: Domain d1mi5a1: 1mi5 A:182-277

Lineage for d1mi5a1 (1mi5 A:182-277)

Root: SCOP 1.69
Class b: All beta proteins [48724] (144 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (4 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
Protein Class I MHC, alpha-3 domain [88604] (3 species)
Species Human (Homo sapiens) [TaxId:9606] [88605] (70 PDB entries)
Domain d1mi5a1: 1mi5 A:182-277 [79142]
Other proteins in same PDB: d1mi5a2, d1mi5b_, d1mi5d1, d1mi5d2, d1mi5e1, d1mi5e2

Details for d1mi5a1

PDB Entry: 1mi5 (more details), 2.5 Å

PDB Description: The crystal structure of LC13 TcR in complex with HLAB8-EBV peptide complex

SCOP Domain Sequences for d1mi5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mi5a1 b.1.1.2 (A:182-277) Class I MHC, alpha-3 domain {Human (Homo sapiens)}
adppkthvthhpisdheatlrcwalgfypaeitltwqrdgedqtqdtelvetrpagdrtf
qkwaavvvpsgeeqrytchvqheglpkpltlrweps

SCOP Domain Coordinates for d1mi5a1:

Click to download the PDB-style file with coordinates for d1mi5a1.
(The format of our PDB-style files is described here.)

Timeline for d1mi5a1: