SCOP 1.65: Domain d1mi5a1: 1mi5 A:182-277

Lineage for d1mi5a1 (1mi5 A:182-277)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)

6. Protein Class I MHC, alpha-3 domain [88604] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88605] (56 PDB entries)

8. Domain d1mi5a1: 1mi5 A:182-277 [79142]
   Other proteins in same PDB: d1mi5a2, d1mi5b_, d1mi5d1, d1mi5d2, d1mi5e1, d1mi5e2

Details for d1mi5a1

PDB Entry: 1mi5, 2.5 Å

PDB Description: The crystal structure of LC13 TcR in complex with HLAB8-EBV peptide complex

SCOP Domain Sequences for d1mi5a1:

Sequence; same for both SEQRES and ATOM records:

>d1mi5a1 b.1.1.2 (A:182-277) Class I MHC, alpha-3 domain {Human (Homo sapiens)}
adppkthvthhpisdheatlrcwalgfypaeitltwqrdgedqtqdtelvetrpagdrtf
qkwaavvvpsgeeqrytchvqheglpkpltlrweps

Timeline for d1mi5a1:

• d1mi5a1 first appeared in SCOP 1.63
  
• d1mi5a1 appears in SCOP 1.67
  
• d1mi5a1 appears in the current release, SCOPe 2.08