Lineage for d1mi5a1 (1mi5 A:182-277)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 287096Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 288543Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)
  6. 288747Protein Class I MHC, alpha-3 domain [88604] (3 species)
  7. 288748Species Human (Homo sapiens) [TaxId:9606] [88605] (56 PDB entries)
  8. 288794Domain d1mi5a1: 1mi5 A:182-277 [79142]
    Other proteins in same PDB: d1mi5a2, d1mi5b_, d1mi5d1, d1mi5d2, d1mi5e1, d1mi5e2

Details for d1mi5a1

PDB Entry: 1mi5 (more details), 2.5 Å

PDB Description: The crystal structure of LC13 TcR in complex with HLAB8-EBV peptide complex

SCOP Domain Sequences for d1mi5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mi5a1 b.1.1.2 (A:182-277) Class I MHC, alpha-3 domain {Human (Homo sapiens)}
adppkthvthhpisdheatlrcwalgfypaeitltwqrdgedqtqdtelvetrpagdrtf
qkwaavvvpsgeeqrytchvqheglpkpltlrweps

SCOP Domain Coordinates for d1mi5a1:

Click to download the PDB-style file with coordinates for d1mi5a1.
(The format of our PDB-style files is described here.)

Timeline for d1mi5a1: