Lineage for d1mi0b1 (1mi0 B:5-62)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2934642Superfamily d.15.7: Immunoglobulin-binding domains [54358] (1 family) (S)
  5. 2934643Family d.15.7.1: Immunoglobulin-binding domains [54359] (3 proteins)
  6. 2934668Protein Immunoglobulin-binding protein G, different constituent domains [54360] (4 species)
  7. 2934705Species Streptococcus sp., group G [TaxId:1306] [54361] (40 PDB entries)
  8. 2934723Domain d1mi0b1: 1mi0 B:5-62 [79136]
    Other proteins in same PDB: d1mi0a2, d1mi0b2
    redesigned protein variant nuG2

Details for d1mi0b1

PDB Entry: 1mi0 (more details), 1.85 Å

PDB Description: crystal structure of the redesigned protein g variant nug2
PDB Compounds: (B:) immunoglobulin-binding protein G

SCOPe Domain Sequences for d1mi0b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mi0b1 d.15.7.1 (B:5-62) Immunoglobulin-binding protein G, different constituent domains {Streptococcus sp., group G [TaxId: 1306]}
amdtyklvivlngttftytteavdaataekvfkqyandngvdgewtyadatktftvte

SCOPe Domain Coordinates for d1mi0b1:

Click to download the PDB-style file with coordinates for d1mi0b1.
(The format of our PDB-style files is described here.)

Timeline for d1mi0b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1mi0b2