Lineage for d1mhxa_ (1mhx A:)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 253998Fold d.15: beta-Grasp (ubiquitin-like) [54235] (10 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 254500Superfamily d.15.7: Immunoglobulin-binding domains [54358] (1 family) (S)
  5. 254501Family d.15.7.1: Immunoglobulin-binding domains [54359] (2 proteins)
  6. 254525Protein Immunoglobulin-binding protein G, different constituent domains [54360] (1 species)
  7. 254526Species Streptococcus sp., group G [TaxId:1306] [54361] (21 PDB entries)
  8. 254530Domain d1mhxa_: 1mhx A: [79134]
    redesigned protein variant nuG1
    mutant

Details for d1mhxa_

PDB Entry: 1mhx (more details), 1.8 Å

PDB Description: crystal structures of the redesigned protein g variant nug1

SCOP Domain Sequences for d1mhxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mhxa_ d.15.7.1 (A:) Immunoglobulin-binding protein G, different constituent domains {Streptococcus sp., group G}
mhhhhhhamdtyklfivigdrvvvvtteavdaataekvfkqyandngvdgewtyddaakt
ftvte

SCOP Domain Coordinates for d1mhxa_:

Click to download the PDB-style file with coordinates for d1mhxa_.
(The format of our PDB-style files is described here.)

Timeline for d1mhxa_: