![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.7: Immunoglobulin-binding domains [54358] (1 family) ![]() |
![]() | Family d.15.7.1: Immunoglobulin-binding domains [54359] (3 proteins) |
![]() | Protein Immunoglobulin light chain-binding domain of protein L [54362] (1 species) |
![]() | Species Peptostreptococcus magnus [TaxId:1260] [54363] (12 PDB entries) |
![]() | Domain d1mhhf_: 1mhh F: [79128] Other proteins in same PDB: d1mhha1, d1mhha2, d1mhhb1, d1mhhb2, d1mhhc1, d1mhhc2, d1mhhd1, d1mhhd2 domain C complexed with edo; mutant |
PDB Entry: 1mhh (more details), 2.1 Å
SCOPe Domain Sequences for d1mhhf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mhhf_ d.15.7.1 (F:) Immunoglobulin light chain-binding domain of protein L {Peptostreptococcus magnus [TaxId: 1260]} evtikvnlifadgkiqtaefkgtfeeataeayryaallakvngewtadledggnhmnikf ag
Timeline for d1mhhf_: