Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (4 species) |
Species Mouse (Mus musculus) [TaxId:10090] [88567] (368 PDB entries) Uniprot P01837# KAC_MOUSE Ig kappa chain C region; 99% sequence identity ! SQ NA # natural chimera; best hits are: Uniprot P01637 (Ig kappa chain V-V region T1) and Uniprot P01837 (Ig kappa chain C region) ! Uniprot P01837 # KAC_MOUSE Ig kappa chain C region ! Uniprot P01837 # KAC_MOUSE (P01837) Ig kappa chain C region ! SQ NA # part of Fab 28 against HIV-1 RT ! Uniprot P01837 # ! KAC_MOUSE Ig kappa chain C region |
Domain d1mhhc2: 1mhh C:108-213 [79124] Other proteins in same PDB: d1mhha1, d1mhhb1, d1mhhb2, d1mhhc1, d1mhhd1, d1mhhd2, d1mhhe_, d1mhhf_ part of anti-HCV Fab 19D9D6 complexed with edo |
PDB Entry: 1mhh (more details), 2.1 Å
SCOPe Domain Sequences for d1mhhc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mhhc2 b.1.1.2 (C:108-213) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus) [TaxId: 10090]} radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd skdstysmsstltltkdeyerhnsytceathktstspivksfnrne
Timeline for d1mhhc2: