SCOP 1.67: Domain d1mhhc2: 1mhh C:108-213

Lineage for d1mhhc2 (1mhh C:108-213)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)

6. Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88567] (270 PDB entries)

8. Domain d1mhhc2: 1mhh C:108-213 [79124]
   Other proteins in same PDB: d1mhha1, d1mhhb1, d1mhhb2, d1mhhc1, d1mhhd1, d1mhhd2, d1mhhe_, d1mhhf_
   part of anti-HCV Fab 19D9D6
   complexed with aea, edo; mutant

Details for d1mhhc2

PDB Entry: 1mhh, 2.1 Å

PDB Description: structure of p. magnus protein l mutant bound to a mouse fab

SCOP Domain Sequences for d1mhhc2:

Sequence; same for both SEQRES and ATOM records:

>d1mhhc2 b.1.1.2 (C:108-213) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus)}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrne

Timeline for d1mhhc2:

• d1mhhc2 first appeared in SCOP 1.63
  
• d1mhhc2 appears in SCOP 1.65
  
• d1mhhc2 appears in SCOP 1.69
  
• d1mhhc2 appears in the current release, SCOPe 2.08