Lineage for d1mhhc2 (1mhh C:108-213)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 220405Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 220881Protein Immunoglobulin (constant domains of L and H chains) [48972] (185 species)
  7. 220956Species Anti-HCV Fab 19D9D6, (mouse), kappa L chain [81953] (3 PDB entries)
  8. 220961Domain d1mhhc2: 1mhh C:108-213 [79124]
    Other proteins in same PDB: d1mhha1, d1mhhb1, d1mhhc1, d1mhhd1, d1mhhe_, d1mhhf_

Details for d1mhhc2

PDB Entry: 1mhh (more details), 2.1 Å

PDB Description: structure of p. magnus protein l mutant bound to a mouse fab

SCOP Domain Sequences for d1mhhc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mhhc2 b.1.1.2 (C:108-213) Immunoglobulin (constant domains of L and H chains) {Anti-HCV Fab 19D9D6, (mouse), kappa L chain}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrne

SCOP Domain Coordinates for d1mhhc2:

Click to download the PDB-style file with coordinates for d1mhhc2.
(The format of our PDB-style files is described here.)

Timeline for d1mhhc2: