SCOP 1.67: Domain d1mhhc1: 1mhh C:1-107

Lineage for d1mhhc1 (1mhh C:1-107)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (24 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 1.2 [TaxId:10090] [88525] (34 PDB entries)

8. Domain d1mhhc1: 1mhh C:1-107 [79123]
   Other proteins in same PDB: d1mhha2, d1mhhb1, d1mhhb2, d1mhhc2, d1mhhd1, d1mhhd2, d1mhhe_, d1mhhf_
   part of anti-HCV Fab 19D9D6
   complexed with aea, edo; mutant

Details for d1mhhc1

PDB Entry: 1mhh, 2.1 Å

PDB Description: structure of p. magnus protein l mutant bound to a mouse fab

SCOP Domain Sequences for d1mhhc1:

Sequence; same for both SEQRES and ATOM records:

>d1mhhc1 b.1.1.1 (C:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.2}
divmsqspsslavsagekvtmsckssqsllnsrtrknylawyqqkpgqspkvliywastr
esgvpdrftgrgsgtdftltissvqaedqavyyckqayippltfgagtklelk

Timeline for d1mhhc1:

• d1mhhc1 first appeared in SCOP 1.63
  
• d1mhhc1 appears in SCOP 1.65
  
• d1mhhc1 appears in SCOP 1.69
  
• d1mhhc1 appears in the current release, SCOPe 2.08