SCOP 1.71: Domain d1mhhb2: 1mhh B:114-212

Lineage for d1mhhb2 (1mhh B:114-212)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88576] (302 PDB entries)

8. Domain d1mhhb2: 1mhh B:114-212 [79122]
   Other proteins in same PDB: d1mhha1, d1mhha2, d1mhhb1, d1mhhc1, d1mhhc2, d1mhhd1, d1mhhe_, d1mhhf_

Details for d1mhhb2

PDB Entry: 1mhh, 2.1 Å

PDB Description: structure of p. magnus protein l mutant bound to a mouse fab

SCOP Domain Sequences for d1mhhb2:

Sequence, based on SEQRES records:

>d1mhhb2 b.1.1.2 (B:114-212) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus)}
akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpsstwpsetvtcnvahpasstkvdkkivp

Sequence, based on observed residues (ATOM records):

>d1mhhb2 b.1.1.2 (B:114-212) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus)}
akttppsvyplapgsaaqsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdly
tlsssvtvpsstwpsetvtcnvahpasstkvdkkivp

Timeline for d1mhhb2:

• d1mhhb2 first appeared in SCOP 1.63
  
• d1mhhb2 appears in SCOP 1.69
  
• d1mhhb2 appears in SCOP 1.73
  
• d1mhhb2 appears in the current release, SCOPe 2.08