![]() | Class b: All beta proteins [48724] (149 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
![]() | Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [88576] (302 PDB entries) |
![]() | Domain d1mhhb2: 1mhh B:114-212 [79122] Other proteins in same PDB: d1mhha1, d1mhha2, d1mhhb1, d1mhhc1, d1mhhc2, d1mhhd1, d1mhhe_, d1mhhf_ |
PDB Entry: 1mhh (more details), 2.1 Å
SCOP Domain Sequences for d1mhhb2:
Sequence, based on SEQRES records: (download)
>d1mhhb2 b.1.1.2 (B:114-212) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus)} akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd lytlsssvtvpsstwpsetvtcnvahpasstkvdkkivp
>d1mhhb2 b.1.1.2 (B:114-212) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus)} akttppsvyplapgsaaqsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdly tlsssvtvpsstwpsetvtcnvahpasstkvdkkivp
Timeline for d1mhhb2: