Lineage for d1mhhb1 (1mhh B:1-113)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2352461Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2352672Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 2353425Species Mouse (Mus musculus), cluster 4 [TaxId:10090] [88554] (34 PDB entries)
    Uniprot P06327 20-117 # HV52_MOUSE (P06327) Ig heavy chain V region VH558 A1/A4 precursor; 57% sequence identity ! Uniprot P01631 # KV2G_MOUSE (P01631) Ig kappa chain V-II region 26-10
  8. 2353429Domain d1mhhb1: 1mhh B:1-113 [79121]
    Other proteins in same PDB: d1mhha1, d1mhha2, d1mhhb2, d1mhhc1, d1mhhc2, d1mhhd2, d1mhhe_, d1mhhf_
    part of anti-HCV Fab 19D9D6
    complexed with edo

Details for d1mhhb1

PDB Entry: 1mhh (more details), 2.1 Å

PDB Description: structure of p. magnus protein l mutant bound to a mouse fab
PDB Compounds: (B:) Fab, heavy chain

SCOPe Domain Sequences for d1mhhb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mhhb1 b.1.1.1 (B:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 4 [TaxId: 10090]}
qiqlvqsgpelkkpgetvkisckasgytftdfsmhwvnqapgkglnwmgwvntetgepty
addfkgrfafsletsastaylqinslknedtatyfcarfllrqyfdvwgagttvtvss

SCOPe Domain Coordinates for d1mhhb1:

Click to download the PDB-style file with coordinates for d1mhhb1.
(The format of our PDB-style files is described here.)

Timeline for d1mhhb1: