Class b: All beta proteins [48724] (141 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins) |
Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species) |
Species Mouse (Mus musculus) [TaxId:10090] [88567] (270 PDB entries) |
Domain d1mhha2: 1mhh A:108-213 [79120] Other proteins in same PDB: d1mhha1, d1mhhb1, d1mhhb2, d1mhhc1, d1mhhd1, d1mhhd2, d1mhhe_, d1mhhf_ |
PDB Entry: 1mhh (more details), 2.1 Å
SCOP Domain Sequences for d1mhha2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mhha2 b.1.1.2 (A:108-213) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus)} radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd skdstysmsstltltkdeyerhnsytceathktstspivksfnrne
Timeline for d1mhha2: